Product Browser

Last updated: 2014/10/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

KCNE1 monoclonal antibody (M13), clone 2A6

  • Catalog # : H00003753-M13
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant KCNE1.
  • Immunogen:
  • KCNE1 (AAH36452, 1 a.a. ~ 105 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MILSNTTAVTPFLTKLWQETVQQGGNMSGLAHRSPRSGDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of KCNE1 transfected lysate using anti-KCNE1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with KCNE1 MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3753
  • Gene Name:
  • KCNE1
  • Gene Alias:
  • FLJ18426,FLJ38123,FLJ94103,ISK,JLNS,JLNS2,LQT2/5,LQT5,MGC33114,MinK
  • Gene Description:
  • potassium voltage-gated channel, Isk-related family, member 1
  • Gene Summary:
  • The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
  • Other Designations:
  • IKs producing slow voltage-gated potassium channel subunit beta Mink,OTTHUMP00000108623,OTTHUMP00000108625,OTTHUMP00000108626,cardiac delayed rectifier potassium channel protein,delayed rectifier potassium channel subunit IsK,minimal potassium channel,pot
  • RSS
  • YouTube
  • Linkedin
  • Facebook