KCNE1 monoclonal antibody (M01), clone 5B12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi ( Cat # H00003753-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody (M01), clone 5B12 (Cat # H00003753-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (32.67 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant KCNE1.
Immunogen
KCNE1 (NP_000210, 67 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVLESYRSCYVVENHLAIEQPNTHLPETKPSP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.67 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged KCNE1 is approximately 3ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of KCNE1 over-expressed 293 cell line, cotransfected with KCNE1 Validated Chimera RNAi ( Cat # H00003753-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with KCNE1 monoclonal antibody (M01), clone 5B12 (Cat # H00003753-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — KCNE1
Entrez GeneID
3753GeneBank Accession#
NM_000219Protein Accession#
NP_000210Gene Name
KCNE1
Gene Alias
FLJ18426, FLJ38123, FLJ94103, ISK, JLNS, JLNS2, LQT2/5, LQT5, MGC33114, MinK
Gene Description
potassium voltage-gated channel, Isk-related family, member 1
Gene Ontology
HyperlinkGene Summary
The product of this gene belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. This gene encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq
Other Designations
IKs producing slow voltage-gated potassium channel subunit beta Mink|OTTHUMP00000108623|OTTHUMP00000108625|OTTHUMP00000108626|cardiac delayed rectifier potassium channel protein|delayed rectifier potassium channel subunit IsK|minimal potassium channel|pot
-
Interactome
-
Disease
-
Publication Reference
-
Chronic in vivo angiotensin II administration differentially modulates the slow delayed rectifier channels in atrial and ventricular myocytes.
Zankov DP, Salloum FN, Jiang M, Tseng GN.
Heart Rhythm 2018 Aug; [Epub].
Application：IF, WB-Ti, Mouse, Atria, Ventricles.
-
Adult Ventricular Myocytes Segregate KCNQ1 and KCNE1 to Keep the IKs Amplitude in Check Until When Larger IKs Is Needed.
Jiang M, Wang Y, Tseng GN.
Circulation. Arrhythmia and Electrophysiology 2017 Jun; 10(6): e005084.
Application：IF, WB, Dog, Dog ventricular myocytes.
-
[Ca2+]i Elevation and Oxidative Stress Induce KCNQ1 Protein Translocation from the Cytosol to the Cell Surface and Increase Slow Delayed Rectifier (IKs) in Cardiac Myocytes.
Wang Y, Zankov DP, Jiang M, Zhang M, Henderson SC, Tseng GN.
The Journal of Biological Chemistry 2013 Dec; 288(49):35358.
Application：IF, WB-Ti, WB-Tr, Guinea pig, Monkey, Rat, Cardiac, Ventricular myocytes, Heart, COS-7 cells, NRVMs.
-
KCNE2 is colocalized with KCNQ1 and KCNE1 in cardiac myocytes and may function as a negative modulator of I(Ks) current amplitude in the heart.
Wu DM, Jiang M, Zhang M, Liu XS, Korolkova YV, Tseng GN.
Heart Rhythm 2006 Dec; 3(12):1469.
Application：IF, WB, Monkey, Rat, COS-7 cells, Rat ventricular myocardium, Rat myocytes.
-
Chronic in vivo angiotensin II administration differentially modulates the slow delayed rectifier channels in atrial and ventricular myocytes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com