ING1 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ING1 expression in transfected 293T cell line (H00003621-T02) by ING1 MaxPab polyclonal antibody.
Lane 1: ING1 transfected lysate(31.90 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ING1 transfected lysate using anti-ING1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ING1 MaxPab mouse polyclonal antibody (B01) (H00003621-B01).
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ING1 protein.
Immunogen
ING1 (NP_937862.1, 1 a.a. ~ 279 a.a) full-length human protein.
Sequence
MLSPANGEQLHLVNYVEDYLDSIESLPFDLQRNVSLMREIDAKYQEILKELDECYERFSRETDGAQKRRMLHCVQRALIRSQELGDEKIQIVSQMVELVENRTRQVDSHVELFEAQQELGDTAGNSGKAGADRPKGEAAAQADKPNSKRSRRQRNNENRENASSNHDHDDGASGTPKEKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCDNDECPIEWFHFSCVGLNHKPKGKWYCPKCRGENEKTMDKALEKSKKERAYNR
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (90); Rat (89)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ING1 expression in transfected 293T cell line (H00003621-T02) by ING1 MaxPab polyclonal antibody.
Lane 1: ING1 transfected lysate(31.90 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ING1 transfected lysate using anti-ING1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ING1 MaxPab mouse polyclonal antibody (B01) (H00003621-B01). -
Gene Info — ING1
Entrez GeneID
3621GeneBank Accession#
NM_198219Protein Accession#
NP_937862.1Gene Name
ING1
Gene Alias
p24ING1c, p33, p33ING1, p33ING1b, p47, p47ING1a
Gene Description
inhibitor of growth family, member 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a tumor suppressor protein that can induce cell growth arrest and apoptosis. The encoded protein is a nuclear protein that physically interacts with the tumor suppressor protein TP53 and is a component of the p53 signaling pathway. Reduced expression and rearrangement of this gene have been detected in various cancers. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq
Other Designations
OTTHUMP00000018703|OTTHUMP00000018704|OTTHUMP00000018705|OTTHUMP00000018706|growth inhibitor ING1|growth inhibitory protein ING1|inhibitor of growth 1|tumor suppressor ING1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com