Product Browser

Last updated: 2014/4/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

IL8 monoclonal antibody (M19), clone 1G9

  • Catalog # : H00003576-M19
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant IL8.
  • Immunogen:
  • IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2b Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00003576-M19
    Western Blot detection against Immunogen (31.69 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 3576
  • Gene Name:
  • IL8
  • Gene Alias:
  • CXCL8,GCP-1,GCP1,LECT,LUCT,LYNAP,MDNCF,MONAP,NAF,NAP-1,NAP1
  • Gene Description:
  • interleukin 8
  • Gene Summary:
  • The protein encoded by this gene is a member of the CXC chemokine family. This chemokine is one of the major mediators of the inflammatory response. This chemokine is secreted by several cell types. It functions as a chemoattractant, and is also a potent angiogenic factor. This gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection. This gene and other ten members of the CXC chemokine gene family form a chemokine gene cluster in a region mapped to chromosome 4q. [provided by RefSeq
  • Other Designations:
  • T cell chemotactic factor,beta-thromboglobulin-like protein,chemokine (C-X-C motif) ligand 8,emoctakin,granulocyte chemotactic protein 1,lymphocyte-derived neutrophil-activating factor,monocyte-derived neutrophil chemotactic factor,neutrophil-activating p
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook