IFI27 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human IFI27 protein.
Immunogen
IFI27 (NP_005523.3, 1 a.a. ~ 119 a.a) full-length human protein.
Sequence
MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IFI27 expression in transfected 293T cell line (H00003429-T02) by IFI27 MaxPab polyclonal antibody.
Lane 1: IFI27 transfected lysate(11.30 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — IFI27
Entrez GeneID
3429GeneBank Accession#
NM_005532.3Protein Accession#
NP_005523.3Gene Name
IFI27
Gene Alias
FAM14D, ISG12, ISG12A, P27
Gene Description
interferon, alpha-inducible protein 27
Omim ID
600009Gene Ontology
HyperlinkGene Summary
O
Other Designations
2310061N23Rik
-
Interactome
-
Disease
-
Publication Reference
-
Interferon α-inducible protein 27 is an oncogene and highly expressed in cholangiocarcinoma patients with poor survival.
Chiang KC, Huang ST, Wu RC, Huang SC, Yeh TS, Chen MH, Hsu JT, Chen LW, Kuo SF, Chueh HY, Juang HH, Hung SI, Yeh CN, Pang JS.
Cancer Management and Research 2019 Feb; 11:1893.
Application:WB-Tr, Human, SNU308 cells.
-
Risk Stratification in Influenza.
Anthony McLean, Benjamin Tang, Grant Peter Parnell, Maryam Shojaei.
United States Patent Application Publication 2015 Nov; [Epub].
Application:ELISA, Human, Serum.
-
IFI27, a novel epidermal growth factor-stabilized protein, is functionally involved in proliferation and cell cycling of human epidermal keratinocytes.
Hsieh WL, Huang YH, Wang TM, Ming YC, Tsai CN, Pang JH.
Cell Proliferation 2015 Apr; 48(2):187.
Application:WB, WB-Tr, Human, HaCaT cells.
-
Interferon α-inducible protein 27 is an oncogene and highly expressed in cholangiocarcinoma patients with poor survival.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com