IDH2 monoclonal antibody (M01), clone 5F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant IDH2.
Immunogen
IDH2 (NP_002159, 354 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGR
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of IDH2 expression in transfected 293T cell line by IDH2 monoclonal antibody (M01), clone 5F11.
Lane 1: IDH2 transfected lysate(50.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to IDH2 on formalin-fixed paraffin-embedded human colon. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged IDH2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — IDH2
Entrez GeneID
3418GeneBank Accession#
NM_002168Protein Accession#
NP_002159Gene Name
IDH2
Gene Alias
ICD-M, IDH, IDHM, IDP, IDPM, mNADP-IDH
Gene Description
isocitrate dehydrogenase 2 (NADP+), mitochondrial
Omim ID
147650Gene Ontology
HyperlinkGene Summary
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the mitochondria. It plays a role in intermediary metabolism and energy production. This protein may tightly associate or interact with the pyruvate dehydrogenase complex. [provided by RefSeq
Other Designations
NADP+-specific ICDH|isocitrate dehydrogenase, mitochondrial|oxalosuccinate decarboxylase
-
Interactome
-
Pathway
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Citrate cycle (TCA cycle)
- Glutathione metabolism
+ View More Disease
-
Disease
-
Publication Reference
-
Biochemical Background in Mitochondria Affects 2HG Production by IDH2 and ADHFE1 in Breast Carcinoma.
Jitka Špačková, Klára Gotvaldová, Aleš Dvořák, Alexandra Urbančoková, Kateřina Pospíšilová, David Větvička, Alberto Leguina-Ruzzi, Petra Tesařová, Libor Vítek, Petr Ježek, Katarína Smolková.
Cancers 2021 Apr; 13(7):1709.
Application:WB-Tr, Human, Hs578T, MCF-7 cells.
-
SIRT3 and GCN5L Regulation of NADP+- And NADPH-driven Reactions of Mitochondrial Isocitrate Dehydrogenase IDH2.
Katarína Smolková, Jitka Špačková, Klára Gotvaldová, Aleš Dvořák, Alena Křenková, Martin Hubálek, Blanka Holendová, Libor Vítek, Petr Ježek.
Scientific Reports 2020 May; 10(1):8677.
Application:WB-Tr, Human, HEK 293LTV cells, Purified proteins.
-
Aconitase 2 inhibits the proliferation of MCF-7 cells promoting mitochondrial oxidative metabolism and ROS/FoxO1-mediated autophagic response.
Ciccarone F, Di Leo L, Lazzarino G, Maulucci G, Di Giacinto F, Tavazzi B, Ciriolo MR.
British Journal of Cancer 2020 Jan; 122(2):182.
Application:WB-Ce, Human, HCC1143, HCC1187, MCF-7, MCF10A, MDA-MB-157, MDA-MB-231, MDA-MB-1187, T-47D cells.
-
A selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats.
Ferreira JCB, Campos JC, Qvit N, Qi X, Bozi LHM, Bechara LRG, Lima VM, Queliconi BB, Disatnik MH, Dourado PMM, Kowaltowski AJ, Mochly-Rosen D.
Nature Communications 2019 Jan; 10(1):329.
Application:WB, Rat, Rat cardiomyocytes.
-
Decreased expression of ten-eleven translocation 2 protein is associated with progressive disease and death in patients with mucosis fungoides.
Gambichler T, Mamali K, Patsinakidis N, Moritz R, Mucke M, Skrygan M, Stockfleth E, Stucker M.
The British Journal of Dermatology 2016 Mar; 174(3):652.
Application:IHC, Human, T cell lymphomas.
-
Altered global methylation and hydroxymethylation status in vulvar lichen sclerosus - further support for epigenetic mechanisms.
Gambichler T, Terras S, Kreuter A, Skrygan M.
The British Journal of Dermatology 2014 Mar; 170(3):687.
Application:IHC, Human, Skin.
-
Biochemical Background in Mitochondria Affects 2HG Production by IDH2 and ADHFE1 in Breast Carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com