ICAM4 MaxPab rabbit polyclonal antibody (D01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ICAM4 protein.
Immunogen
ICAM4 (NP_001034221.1, 1 a.a. ~ 272 a.a) full-length human protein.
Sequence
MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (59); Rat (67)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
No additive
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ICAM4 expression in transfected 293T cell line (H00003386-T02) by ICAM4 MaxPab polyclonal antibody.
Lane 1: ICAM4 transfected lysate(29.60 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of ICAM4 transfected lysate using anti-ICAM4 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with ICAM4 purified MaxPab mouse polyclonal antibody (B01P) (H00003386-B01P). -
Gene Info — ICAM4
Entrez GeneID
3386GeneBank Accession#
NM_001039132.1Protein Accession#
NP_001034221.1Gene Name
ICAM4
Gene Alias
CD242, LW
Gene Description
intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
Omim ID
111250Gene Ontology
HyperlinkGene Summary
This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
CD242 antigen|Landsteiner-Wiener blood group antigen a|Landsteiner-Wiener blood group glycoprotein|intercellular adhesion molecule 4|intercellular adhesion molecule 4 (LW blood group)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com