ICAM4 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human ICAM4 protein.
Immunogen
ICAM4 (NP_001034221.1, 1 a.a. ~ 272 a.a) full-length human protein.
Sequence
MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (59); Rat (67)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ICAM4 expression in transfected 293T cell line (H00003386-T01) by ICAM4 MaxPab polyclonal antibody.
Lane 1: ICAM4 transfected lysate(29.92 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — ICAM4
Entrez GeneID
3386GeneBank Accession#
NM_001039132.1Protein Accession#
NP_001034221.1Gene Name
ICAM4
Gene Alias
CD242, LW
Gene Description
intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
Omim ID
111250Gene Ontology
HyperlinkGene Summary
This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
CD242 antigen|Landsteiner-Wiener blood group antigen a|Landsteiner-Wiener blood group glycoprotein|intercellular adhesion molecule 4|intercellular adhesion molecule 4 (LW blood group)
-
Interactome
-
Disease
-
Publication Reference
-
Apheresis causes complement deposition on red blood cells (RBCs) and RBC antigen alterations, possibly inducing enhanced clearance.
de Back DZ, Nezjad SG, Beuger BM, Veldhuis M, Clifford E, Ait Ichou F, Berghuis J, Go M, Gouwerok E, Meinderts S, Vrielink H, de Kort W, de Korte D, van Kraaij M, van Bruggen R.
Transfusion 2018 Nov; 58(11):2627.
Application:Flow Cyt, Human, Red blood cells.
-
Impaired adenosine-5'-triphosphate release from red blood cells promotes their adhesion to endothelial cells: a mechanism of hypoxemia after transfusion.
Zhu H, Zennadi R, Xu BX, Eu JP, Torok JA, Telen MJ, McMahon TJ.
Critical Care Medicine 2011 Nov; 39(11):2478.
Application:Func, Mouse, Red blood cell.
-
Apheresis causes complement deposition on red blood cells (RBCs) and RBC antigen alterations, possibly inducing enhanced clearance.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com