HOXB5 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HOXB5 partial ORF ( NP_002138.1, 170 a.a. - 267 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
EGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAF
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.52
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HOXB5
Entrez GeneID
3215GeneBank Accession#
NM_002147Protein Accession#
NP_002138.1Gene Name
HOXB5
Gene Alias
HHO.C10, HOX2, HOX2A, HU-1, Hox2.1
Gene Description
homeobox B5
Omim ID
142960Gene Ontology
HyperlinkGene Summary
This gene is a member of the Antp homeobox family and encodes a nuclear protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded protein functions as a sequence-specific transcription factor that is involved in lung and gut development. Increased expression of this gene is associated with a distinct biologic subset of acute myeloid leukemia (AML) and the occurrence of bronchopulmonary sequestration (BPS) and congenital cystic adenomatoid malformation (CCAM) tissue. [provided by RefSeq
Other Designations
homeo box 2A|homeo box B5
-
Interactome
-
Publication Reference
-
Homeobox b5 (Hoxb5) regulates the expression of Forkhead box D3 gene (Foxd3) in neural crest.
Kam MK, Cheung M, Zhu JJ, Cheng WW, Sat EW, Tam PK, Lui VC.
The International Journal of Biochemistry & Cell Biology 2014 Oct; 55:144.
Application:Electro-mobility shift assay, DNA.
-
HOXB5 Cooperates with NKX2-1 in the Transcription of Human RET.
Zhu J, Garcia-Barcelo MM, Tam PK, Lui VC.
PLoS One 2011 Jun; 6(6):e20815.
Application:EMSA, Human, SK-N-SH cells.
-
Homeobox b5 (Hoxb5) regulates the expression of Forkhead box D3 gene (Foxd3) in neural crest.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com