FOXA2 monoclonal antibody (M01), clone 7E6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FOXA2.
Immunogen
FOXA2 (NP_068556, 363 a.a. ~ 457 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
HLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNSS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.19 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FOXA2 monoclonal antibody (M01), clone 7E6 Western Blot analysis of FOXA2 expression in HepG2 ( Cat # L019V1 ).Western Blot (Transfected lysate)
Western Blot analysis of FOXA2 expression in transfected 293T cell line by FOXA2 monoclonal antibody (M01), clone 7E6.
Lane 1: FOXA2 transfected lysate(48.3 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of FOXA2 transfected lysate using anti-FOXA2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FOXA2 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FOXA2 is approximately 0.03ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of FOXA2 over-expressed 293 cell line, cotransfected with FOXA2 Validated Chimera RNAi ( Cat # H00003170-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with FOXA2 monoclonal antibody (M01), clone 7E6 (Cat # H00003170-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.Immunofluorescence
Immunofluorescence of monoclonal antibody to FOXA2 on HepG2 cell. [antibody concentration 10 ug/ml] -
Gene Info — FOXA2
Entrez GeneID
3170GeneBank Accession#
NM_021784Protein Accession#
NP_068556Gene Name
FOXA2
Gene Alias
HNF3B, MGC19807, TCF3B
Gene Description
forkhead box A2
Omim ID
600288Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000030409|OTTHUMP00000030410|hepatic nuclear factor-3-beta|hepatocyte nuclear factor 3, beta
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
SOX transcription factors direct TCF-independent WNT/β-catenin responsive transcription to govern cell fate in human pluripotent stem cells.
Shreyasi Mukherjee, David M Luedeke, Leslie McCoy, Makiko Iwafuchi, Aaron M Zorn.
Cell Reports 2022 Aug; 40(8):111247.
Application:IF, Human, HEK 293T cells.
-
Generation of human antral and fundic gastric organoids from pluripotent stem cells.
Broda TR, McCracken KW, Wells JM.
Nature Protocols 2019 Jan; 14(1):28.
Application:IF, Human, Human pluripotent stem cells.
-
Tumour resistance in induced pluripotent stem cells derived from naked mole-rats.
Miyawaki S, Kawamura Y, Oiwa Y, Shimizu A, Hachiya T, Bono H, Koya I, Okada Y, Kimura T, Tsuchiya Y, Suzuki S, Onishi N, Kuzumaki N, Matsuzaki Y, Narita M, Ikeda E, Okanoya K, Seino K, Saya H, Okano H, Miura K.
Nature Communications 2016 May; 7:11471.
Application:IF, Mouse, Embryoid body.
-
SOX transcription factors direct TCF-independent WNT/β-catenin responsive transcription to govern cell fate in human pluripotent stem cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com