HMGB1 monoclonal antibody (M08), clone 2F6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HMGB1.
Immunogen
HMGB1 (NP_002119, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HMGB1 monoclonal antibody (M08), clone 2F6 Western Blot analysis of HMGB1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Transfected lysate)
Western Blot analysis of HMGB1 expression in transfected 293T cell line by HMGB1 monoclonal antibody (M08), clone 2F6.
Lane 1: HMGB1 transfected lysate(25 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HMGB1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HMGB1 is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HMGB1 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — HMGB1
Entrez GeneID
3146GeneBank Accession#
NM_002128Protein Accession#
NP_002119Gene Name
HMGB1
Gene Alias
DKFZp686A04236, HMG1, HMG3, SBP-1
Gene Description
high-mobility group box 1
Omim ID
163905Gene Ontology
HyperlinkOther Designations
Amphoterin|OTTHUMP00000018199|OTTHUMP00000190860|Sulfoglucuronyl carbohydrate binding protein|high mobility group box 1|high mobility group protein 1|high-mobility group (nonhistone chromosomal) protein 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Blockade of HMGB1 Attenuates Diabetic Nephropathy in Mice.
Chen X, Ma J, Kwan T, Stribos EGD, Messchendorp AL, Loh YW, Wang X, Paul M, Cunningham EC, Habib M, Alexander IE, Sharland AF, Chadban SJ, Wu H.
Scientific Reports 2018 May; 8(1):8319.
Application:IP-WB, Human, HEK293-pAM2AA-esRAGE cells.
-
HMGB1 is upregulated in the airways in asthma and potentiates airway smooth muscle contraction via TLR4.
Di Candia L, Gomez E, Venereau E, Chachi L, Kaur D, Bianchi ME, Challiss RA, Brightling CE, Saunders RM.
The Journal of Allergy and Clinical Immunology 2017 Feb; [Epub].
Application:IF, Human, ASM cells.
-
The Anti-Inflammatory Activity of HMGB1 A Box Is Enhanced When Fused with C-Terminal Acidic Tail.
Gong W, Zheng Y, Chao F, Li Y, Xu Z, Huang G, Gao X, Li S, He F.
Journal of Biomedicine & Biotechnology 2010 Apr; 2010:915234.
Application:WB-Re, E. coli, E. coli.
-
Functional dissection of an IFN-alpha/beta receptor 1 promoter variant that confers higher risk to chronic hepatitis B virus infection.
Zhou J, Huang JD, Poon VK, Chen DQ, Chan CC, Ng F, Guan XY, Watt RM, Lu L, Yuen KY, Zheng BJ.
Journal of Hepatology 2009 Aug; 51(2):322.
Application:ChIP, Human, HepG2 cells.
-
Blockade of HMGB1 Attenuates Diabetic Nephropathy in Mice.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com