Product Browser

Last updated: 2014/9/1

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HIST1H1T purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00003010-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human HIST1H1T protein.
  • Immunogen:
  • HIST1H1T (ABZ92491.1, 1 a.a. ~ 207 a.a) full-length human protein.
  • Sequence:
  • MSETVPAASASAGVAAMEKLPTKKRGRKPAGLISASRKVPNLSVSKLITEALSVSQERVGMSLVALKKALAAAGYDVEKNNSRIKLSLKSLVNKGILVQTRGTGASGSFKLSKKVIPKSTRSKAKKSVSAKTKKLVLSRDSKSPKTAKTNKRAKKPRATTPKTVRSGRKAKGAKGKQQQKSPVKARASKSKLTQHHEVNVRKATSKK
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 3010
  • Gene Name:
  • HIST1H1T
  • Gene Alias:
  • H1FT,H1t,MGC163222,dJ221C16.2
  • Gene Description:
  • histone cluster 1, H1t
  • Gene Summary:
  • Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6. [provided by RefSeq
  • Other Designations:
  • H1 histone family, member T (testis-specific),OTTHUMP00000016147,histone 1, H1t
  • RSS
  • YouTube
  • Linkedin
  • Facebook