GTF2I monoclonal antibody (M01), clone 3E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant GTF2I.
Immunogen
GTF2I (AAH04472.1, 36 a.a. ~ 274 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (52.03 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GTF2I monoclonal antibody (M01), clone 3E2. Western Blot analysis of GTF2I expression in human colon.Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to GTF2I on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GTF2I is approximately 0.03ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GTF2I on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — GTF2I
Entrez GeneID
2969GeneBank Accession#
BC004472Protein Accession#
AAH04472.1Gene Name
GTF2I
Gene Alias
BAP-135, BAP135, BTKAP1, DIWS, FLJ38776, FLJ56355, IB291, SPIN, TFII-I, WBS, WBSCR6
Gene Description
general transcription factor II, i
Gene Ontology
HyperlinkGene Summary
This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21. [provided by RefSeq
Other Designations
BTK-associated protein, 135kD|Bruton tyrosine kinase-associated protein 135|Williams-Beuren syndrome chromosome region 6
-
Interactome
-
Pathway
-
Publication Reference
-
An SNP in an ultraconserved regulatory element affects Dlx5/Dlx6 regulation in the forebrain.
Poitras L, Yu M, Lesage-Pelletier C, Macdonald RB, Gagne JP, Hatch G, Kelly I, Hamilton SP, Rubenstein JL, Poirier GG, Ekker M.
Development 2010 Sep; 137(18):3089.
Application:IHC, WB, Mouse, Brain.
-
An SNP in an ultraconserved regulatory element affects Dlx5/Dlx6 regulation in the forebrain.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com