Product Browser
 
  • Related Product Showcase
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

GSTZ1 MaxPab rabbit polyclonal antibody (D01)   MaxPab

  • Catalog # : H00002954-D01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 uL
  • USD $ 359
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human GSTZ1 protein.
  • Immunogen:
  • GSTZ1 (NP_665877.1, 1 a.a. ~ 216 a.a) full-length human protein.
  • Sequence:
  • MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
  • Host:
  • Rabbit
  • Reactivity:
  • Human, Mouse
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • GSTZ1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTZ1 expression in human liver.
  • Protocol Download
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • GSTZ1 MaxPab rabbit polyclonal antibody. Western Blot analysis of GSTZ1 expression in mouse liver.
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of GSTZ1 expression in transfected 293T cell line (H00002954-T01) by GSTZ1 MaxPab polyclonal antibody.

    Lane 1: GSTZ1 transfected lysate(24.1 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of GSTZ1 transfected lysate using anti-GSTZ1 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GSTZ1 purified MaxPab mouse polyclonal antibody (B01P) (H00002954-B01P).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 2954
  • Gene Name:
  • GSTZ1
  • Gene Alias:
  • GSTZ1-1,MAAI,MAI,MGC2029
  • Gene Description:
  • glutathione transferase zeta 1
  • Gene Summary:
  • This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq
  • Other Designations:
  • S-(hydroxyalkyl)glutathione lyase,glutathione S-alkyltransferase,glutathione S-aralkyltransferase,glutathione S-aryltransferase,glutathione s-transferase Zeta 1,maleylacetoacetate isomerase,maleylacetone isomerase
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!