GSTT1 monoclonal antibody (M01), clone 2E10-1B2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant GSTT1.
Immunogen
GSTT1 (AAH07065, 1 a.a. ~ 240 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDACAQVNPLKKVPALKDGDFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMFPVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGAGCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (52.14 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — GSTT1
Entrez GeneID
2952GeneBank Accession#
BC007065Protein Accession#
AAH07065Gene Name
GSTT1
Gene Alias
-
Gene Description
glutathione S-transferase theta 1
Omim ID
600436Gene Ontology
HyperlinkGene Summary
Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis. The GSTT1 gene is located approximately 50kb away from the GSTT2 gene. The GSTT1 and GSTT2 genes have a similar structure, being composed of five exons with identical exon/intron boundaries. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
The prognostic and predictive power of redox protein expression for anthracycline-based chemotherapy response in locally advanced breast cancer.
Woolston CM, Zhang L, Storr SJ, Al-Attar A, Shehata M, Ellis IO, Chan SY, Martin SG.
Modern Pathology 2012 Aug; 25(8):1106.
Application:IHC, Human, Human breast cancer.
-
Redox Protein Expression Predicts Radiotherapeutic Response in Early-Stage Invasive Breast Cancer Patients.
Woolston CM, Al-Attar A, Storr SJ, Ellis IO, Morgan DA, Martin SG.
International Journal of Radiation Oncology, Biology, Physics 2011 Apr; 79(5):1532.
Application:IHC-P, Human, Tissue microarray.
-
Effects of Azithromycin (AZM) on Glutathione-S-Transferases (GST)s in Cystic Fibrosis Airway Cells.
Bergamini G, Cigana C, Sorio C, Della Peruta M, Pompella A, Corti A, Huaux FA, Leal T, Assael BM, Melotti P.
American Journal of Respiratory Cell and Molecular Biology 2009 Aug; 41(2):199.
Application:WB, Human, 2CFSMEo-, IB3-1 cells.
-
Anti-glutathione S-transferase T1 antibody-mediated rejection in C4d-positive renal allograft recipients.
Aguilera I, Alvarez-Marquez A, Gentil MA, Fernandez-Alonso J, Fijo J, Saez C, Wichmann I, Nunez-Roldan A.
Nephrology, Dialysis, Transplantation 2008 Feb; 23(7):2393.
Application:IHC-P, Human, Renal biopsies from the patients with chronic antibody-mediated rejection (CAMR).
-
The prognostic and predictive power of redox protein expression for anthracycline-based chemotherapy response in locally advanced breast cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com