Product Browser
 
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

CXCL2 (Human) Recombinant Protein   HuPro Protein

  • Catalog # : H00002920-H01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 25 ug
  • USD $ 700
  • Stock Image
  • order now, ship in 2 weeks
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Purified CXCL2 (NP_002080.1, 35 a.a. - 107 a.a.) human recombinant protein with His-Flag-StrepII tag at N-terminus expressed in human cells.
  • Transfected Cell Line:
  • Human HEK293T cells
  • Sequence:
  • APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 13.31
  • Form:
  • Liquid
  • Preparation Method:
  • Transfection of pSuper-CXCL2 plasmid into HEK293T cell, and the expressed protein was purified by Strep-Tactin affinity column.
  • Purification:
  • Strep-Tactin affinity columns
  • Concentration:
  • > 10 ug/ml
  • Activity:
  • Not Tested
  • Quality Control Testing:
  • SDS-PAGE

    QC Testing of H00002920-H01
  • Storage Buffer:
  • 100 mM Tris-HCl pH 8.0, 150 mM NaCl, 1 mM EDTA, and 5 mM desthiobiotin.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • SDS-PAGE
  • Protein Interaction
  • Gene Information
  • Entrez GeneID:
  • 2920
  • Gene Name:
  • CXCL2
  • Gene Alias:
  • CINC-2a,GRO2,GROb,MGSA-b,MIP-2a,MIP2,MIP2A,SCYB2
  • Gene Description:
  • chemokine (C-X-C motif) ligand 2
  • Other Designations:
  • GRO2 oncogene,MGSA beta,melanoma growth stimulatory activity beta
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!