GLS monoclonal antibody (M01), clone 5C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GLS.
Immunogen
GLS (NP_055720, 580 a.a. ~ 669 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.64 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged GLS is approximately 0.3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to GLS on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — GLS
Entrez GeneID
2744GeneBank Accession#
NM_014905Protein Accession#
NP_055720Gene Name
GLS
Gene Alias
AAD20, DKFZp686O15119, FLJ10358, GLS1, KIAA0838
Gene Description
glutaminase
Omim ID
138280Gene Ontology
HyperlinkGene Summary
Sahai (1983) [PubMed 6825316] demonstrated phosphate-activated glutaminase (EC 3.5.1.2) in human platelets. It is the major enzyme yielding glutamate from glutamine. Significance of the enzyme derives from its possible implication in behavior disturbances in which glutamate acts as a neurotransmitter (Prusiner, 1981). High heritability of platelet glutaminase was indicated by studies of Sahai and Vogel (1983) [PubMed 6682827] who found an intraclass correlation coefficient of 0.96 for monozygotic twins and 0.53 for dizygotic twins.[supplied by OMIM
Other Designations
K-glutaminase|L-glutamine amidohydrolase|glutaminase C|glutaminase, phosphate-activated
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Elucidating the role of N-acetylglucosamine in Group A Carbohydrate for the development of an effective glycoconjugate vaccine against Group A Streptococcus.
Olimpia Pitirollo, Roberta Di Benedetto, Pedro Henriques, Gianmarco Gasperini, Francesca Mancini, Martina Carducci, Luisa Massai, Omar Rossi, Anne Geert Volbeda, Jeroen D C Codée, Francesco Berlanda Scorza, Danilo Gomes Moriel, Francesca Necchi, Luigi Lay, Roberto Adamo, Francesca Micoli.
Carbohydrate Polymers 2023 Jul; 311:120736.
Application:Cap Ab, Recombinant proteins, Recombinant proteins.
-
Combination of neonatal PolyI:C and adolescent phencyclidine treatments is required to induce behavioral abnormalities with overexpression of GLAST in adult mice.
Hida H, Mouri A, Ando Y, Mori K, Mamiya T, Iwamoto K, Ozaki N, Yamada K, Nabeshima T, Noda Y.
Behavioural Brain Research 2014 Jan; 258:34.
Application:WB-Ti, Mouse, Prefrontal cortex.
-
Control of glutamine metabolism by the tumor suppressor Rb.
Reynolds MR, Lane AN, Robertson B, Kemp S, Liu Y, Hill BG, Dean DC, Clem BF.
Oncogene 2014 Jan; 33(5):556.
Application:WB, Mouse, MEF cells.
-
Mitochondrial localization and structure-based phosphate activation mechanism of Glutaminase C with implications for cancer metabolism.
Cassago A, Ferreira AP, Ferreira IM, Fornezari C, Gomes ER, Greene KS, Pereira HM, Garratt RC, Dias SM, Ambrosio AL.
PNAS 2012 Jan; 109(4):1092.
Application:WB, IF, Human, SKBR3, MDA-MB231,PC3, DU145, A549.
-
Premature senescence of human endothelial cells induced by inhibition of glutaminase.
Unterluggauer H, Mazurek S, Lener B, Hutter E, Eigenbrodt E, Zwerschke W, Jansen-Durr P.
Biogerontology 2008 Mar; 9(4):247.
Application:WB-Ce, Human, HUVEC.
-
Elucidating the role of N-acetylglucosamine in Group A Carbohydrate for the development of an effective glycoconjugate vaccine against Group A Streptococcus.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com