GBE1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GBE1 MaxPab polyclonal antibody. Western Blot analysis of GBE1 expression in human liver.
Western Blot (Transfected lysate)
Western Blot analysis of GBE1 expression in transfected 293T cell line (H00002632-T01) by GBE1 MaxPab polyclonal antibody.
Lane 1: GBE1 transfected lysate(77.22 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human GBE1 protein.
Immunogen
GBE1 (AAH12098.1, 1 a.a. ~ 702 a.a) full-length human protein.
Sequence
MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNMFDGTDSCYFHSGPRGTHDLWDSRLFAYSSWEVLRFLLSNIRWWLEEYRFDGFRFDGVTSMLYHHHGVGQGFSGDYSEYFGLQVDEDALTYLMLANHLVHTLCPDSITIAEDVSGMPALCSPISQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGDIVYTLTNRRYLEKCIAYAESHDQALVGDKSLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNFDRDMNRLEERYGWLAAPQAYVSEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92); Rat (92)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GBE1 MaxPab polyclonal antibody. Western Blot analysis of GBE1 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of GBE1 expression in transfected 293T cell line (H00002632-T01) by GBE1 MaxPab polyclonal antibody.
Lane 1: GBE1 transfected lysate(77.22 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GBE1
Entrez GeneID
2632GeneBank Accession#
BC012098.1Protein Accession#
AAH12098.1Gene Name
GBE1
Gene Alias
GBE
Gene Description
glucan (1,4-alpha-), branching enzyme 1
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersen's disease). [provided by RefSeq
Other Designations
amylo-(1,4 to 1,6) transglucosidase|amylo-(1,4 to 1,6) transglycosylase|glycogen branching enzyme|glycogen storage disease type IV
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com