GATA2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
GATA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GATA2 expression in human placenta.
Western Blot (Tissue lysate)
GATA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GATA2 expression in mouse brain.
Western Blot (Transfected lysate)
Western Blot analysis of GATA2 expression in transfected 293T cell line (H00002624-T02) by GATA2 MaxPab polyclonal antibody.
Lane 1: GATA2 transfected lysate(50.50 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human GATA2 protein.
Immunogen
GATA2 (NP_116027.2, 1 a.a. ~ 480 a.a) full-length human protein.
Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
GATA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GATA2 expression in human placenta.Western Blot (Tissue lysate)
GATA2 MaxPab rabbit polyclonal antibody. Western Blot analysis of GATA2 expression in mouse brain.Western Blot (Transfected lysate)
Western Blot analysis of GATA2 expression in transfected 293T cell line (H00002624-T02) by GATA2 MaxPab polyclonal antibody.
Lane 1: GATA2 transfected lysate(50.50 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — GATA2
Entrez GeneID
2624GeneBank Accession#
NM_032638.3Protein Accession#
NP_116027.2Gene Name
GATA2
Gene Alias
MGC2306, NFE1B
Gene Description
GATA binding protein 2
Omim ID
137295Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants
Other Designations
GATA-binding protein 2
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com