Product Browser

Last updated: 2014/7/21

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GALNS (Human) Recombinant Protein (Q01)

  • Catalog # : H00002588-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GALNS partial ORF ( NP_000503, 423 a.a. - 522 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • NVSGVTTHNLEDHTKLPLIFHLGRDPGERFPLSFASAEYQEALSRITSVVQQHQEALVPAQPQLNVCNWAVMNWAPPGCEKLGKCLTPPESIPKKCLWSH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002588-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2588
  • Gene Name:
  • GALNS
  • Gene Alias:
  • FLJ17434,FLJ42844,FLJ98217,GALNAC6S,GAS,MPS4A
  • Gene Description:
  • galactosamine (N-acetyl)-6-sulfate sulfatase
  • Gene Summary:
  • This gene encodes N-acetylgalactosamine-6-sulfatase which is a lysosomal exohydrolase required for the degradation of the glycosaminoglycans, keratan sulfate, and chondroitin 6-sulfate. Sequence alterations including point, missense and nonsense mutations, as well as those that affect splicing, result in a deficiency of this enzyme. Deficiencies of this enzyme lead to Morquio A syndrome, a lysosomal storage disorder. [provided by RefSeq
  • Other Designations:
  • chondroitinase
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook