GAB1 monoclonal antibody (M01), clone 1B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CRKL and GAB1. Mahlavu cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-GAB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to GAB1 on HeLa cell . [antibody concentration 40 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant GAB1.
Immunogen
GAB1 (NP_997006, 625 a.a. ~ 724 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPPKSVK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (87)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CRKL and GAB1. Mahlavu cells were stained with anti-CRKL rabbit purified polyclonal 1:1200 and anti-GAB1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to GAB1 on HeLa cell . [antibody concentration 40 ug/ml] -
Gene Info — GAB1
Entrez GeneID
2549GeneBank Accession#
NM_207123Protein Accession#
NP_997006Gene Name
GAB1
Gene Alias
-
Gene Description
GRB2-associated binding protein 1
Omim ID
604439Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the IRS1-like multisubstrate docking protein family. It is an important mediator of branching tubulogenesis and plays a central role in cellular growth response, transformation and apoptosis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Dramatic Response to Crizotinib in a Patient with Lung Cancer Positive for an HLA-DRB1-MET Gene Fusion.
Davies KD, Ng TL, Estrada-Bernal A, Le AT, Ennever PR, Camidge DR, Doebele RC, Aisner DL.
JCO Precision Oncology 2017 Aug; 2017(1).
Application：PLA, Human, Lung tissue.
-
Dramatic Response to Crizotinib in a Patient with Lung Cancer Positive for an HLA-DRB1-MET Gene Fusion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com