Product Browser

Last updated: 2014/7/28

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FXN (Human) Recombinant Protein (Q01)

  • Catalog # : H00002395-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FXN partial ORF (AAH48097.1, 91 a.a. - 200 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • DETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.84
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002395-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2395
  • Gene Name:
  • FXN
  • Gene Alias:
  • CyaY,FA,FARR,FRDA,MGC57199,X25
  • Gene Description:
  • frataxin
  • Gene Summary:
  • This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021428
  • RSS
  • YouTube
  • Linkedin
  • Facebook