Product Browser

Last updated: 2014/7/14
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FXN MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00002395-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human FXN protein.
  • Immunogen:
  • FXN (AAH48097.1, 1 a.a. ~ 210 a.a) full-length human protein.
  • Sequence:
  • MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FXN expression in transfected 293T cell line (H00002395-T01) by FXN MaxPab polyclonal antibody.

    Lane 1: FXN transfected lysate(23.1 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of FXN transfected lysate using anti-FXN MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FXN purified MaxPab mouse polyclonal antibody (B01P) (H00002395-B01P).
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 2395
  • Gene Name:
  • FXN
  • Gene Alias:
  • CyaY,FA,FARR,FRDA,MGC57199,X25
  • Gene Description:
  • frataxin
  • Gene Summary:
  • This nuclear gene encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000021428
  • RSS
  • YouTube
  • Linkedin
  • Facebook