FLOT2 monoclonal antibody (M03), clone 3G6
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FLOT2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of FLOT2 expression in human stomach.
Western Blot (Cell lysate)
FLOT2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of FLOT2 expression in A-431.
Western Blot (Transfected lysate)
Western Blot analysis of FLOT2 expression in transfected 293T cell line by FLOT2 monoclonal antibody (M03), clone 3G6.
Lane 1: FLOT2 transfected lysate (Predicted MW: 41.7 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of FLOT2 transfected lysate using anti-FLOT2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FLOT2 monoclonal antibody.
Western Blot detection against Immunogen (67.43 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant FLOT2.
Immunogen
FLOT2 (AAH17292, 1 a.a. ~ 379 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (67.43 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FLOT2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of FLOT2 expression in human stomach.Western Blot (Cell lysate)
FLOT2 monoclonal antibody (M03), clone 3G6. Western Blot analysis of FLOT2 expression in A-431.Western Blot (Transfected lysate)
Western Blot analysis of FLOT2 expression in transfected 293T cell line by FLOT2 monoclonal antibody (M03), clone 3G6.
Lane 1: FLOT2 transfected lysate (Predicted MW: 41.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of FLOT2 transfected lysate using anti-FLOT2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FLOT2 monoclonal antibody.ELISA
-
Gene Info — FLOT2
Entrez GeneID
2319GeneBank Accession#
BC017292Protein Accession#
AAH17292Gene Name
FLOT2
Gene Alias
ECS-1, ECS1, ESA, ESA1, M17S1
Gene Description
flotillin 2
Omim ID
131560Gene Ontology
HyperlinkGene Summary
Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq
Other Designations
Flotillin 2 (epidermal surface antigen 1)|membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal antibody ECS-1)
-
Interactome
-
Pathway
-
Publication Reference
-
Genomic erosion and horizontal gene transfer shape functional differences of the ExlA toxin in Pseudomonas spp.
Viviana Job, Laura Gomez-Valero, Adèle Renier, Christophe Rusniok, Stephanie Bouillot, Viviane Chenal-Francisque, Erwan Gueguen, Annie Adrait, Mylène Robert-Genthon, Katy Jeannot, Peter Panchev, Sylvie Elsen, Marie-Odile Fauvarque, Yohann Couté, Carmen Buchrieser, Ina Attrée.
iScience 2022 Jun; 25(7):104596.
Application：WB-Ce, Human, A549 cells.
-
Genomic erosion and horizontal gene transfer shape functional differences of the ExlA toxin in Pseudomonas spp.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com