FLOT2 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FLOT2 protein.
Immunogen
FLOT2 (AAH17292, 1 a.a. ~ 379 a.a) full-length human protein.
Sequence
MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FLOT2 MaxPab polyclonal antibody. Western Blot analysis of FLOT2 expression in human liver.Western Blot (Transfected lysate)
Western Blot analysis of FLOT2 expression in transfected 293T cell line (H00002319-T01) by FLOT2 MaxPab polyclonal antibody.
Lane 1: FLOT2 transfected lysate(41.8 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to FLOT2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.5 ug/ml] -
Gene Info — FLOT2
Entrez GeneID
2319GeneBank Accession#
BC017292Protein Accession#
-Gene Name
FLOT2
Gene Alias
ECS-1, ECS1, ESA, ESA1, M17S1
Gene Description
flotillin 2
Omim ID
131560Gene Ontology
HyperlinkGene Summary
Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq
Other Designations
Flotillin 2 (epidermal surface antigen 1)|membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal antibody ECS-1)
-
Interactome
-
Pathway
-
Publication Reference
-
From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
Chen TC, Lee SA, Hong TM, Shih JY, Lai JM, Chiou HY, Yang SC, Chan CH, Kao CY, Yang PC, Huang CY.
Journal of Proteome Research 2009 Nov; 8(11):4943.
Application:IF, Human, CL1-0, HeLa cells.
-
From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com