- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25895)
- MaxPab® Ab (16205)
- Monoclonal Ab (21428)
- Polyclonal Ab (27861)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9169)
- Ab Pairs/Kits (7710)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2004)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2136)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (18054)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > MaxPab® Ab > Human > Cell Ad/Junc/Cytoskel > FLOT2 purified MaxPab mouse polyclonal antibody (B01P)
FLOT2 purified MaxPab mouse polyclonal antibody (B01P) 
- Catalog # : H00002319-B01P
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 50 ug
- USD $ 319
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Mouse polyclonal antibody raised against a full-length human FLOT2 protein.
- Immunogen:
- FLOT2 (AAH17292, 1 a.a. ~ 379 a.a) full-length human protein.
- Sequence:
- MTLQPRCEDVETAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTVEQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDADIGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLAYELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQIAEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAKIAAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKKATGVQV
- Host:
- Mouse
- Reactivity:
- Human
- Quality Control Testing:
- Antibody reactive against mammalian transfected lysate.
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Publication Reference
- 1.
- From midbody protein-protein interaction network construction to novel regulators in cytokinesis.
Chen TC, Lee SA, Hong TM, Shih JY, Lai JM, Chiou HY, Yang SC, Chan CH, Kao CY, Yang PC, Huang CY.J Proteome Res. 2009 Nov;8(11):4943-53.
- Applications
- Western Blot (Tissue lysate)
- FLOT2 MaxPab polyclonal antibody. Western Blot analysis of FLOT2 expression in human liver.
- Protocol Download
- Western Blot (Transfected lysate)
- Western Blot analysis of FLOT2 expression in transfected 293T cell line (H00002319-T01) by FLOT2 MaxPab polyclonal antibody.
Lane 1: FLOT2 transfected lysate(41.8 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
enlarge this image- Immunoperoxidase of purified MaxPab antibody to FLOT2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.5 ug/ml]
- Protocol Download
- Entrez GeneID:
- 2319
- GeneBank Accession#:
- BC017292
- Protein Accession#:
- -
- Gene Name:
- FLOT2
- Gene Alias:
- ECS-1,ECS1,ESA,ESA1,M17S1
- Gene Description:
- flotillin 2
- Omim ID:
- 131560
- Gene Ontology:
- Hyperlink
- Gene Summary:
- Caveolae are small domains on the inner cell membrane involved in vesicular trafficking and signal transduction. This gene encodes a caveolae-associated, integral membrane protein, which is thought to function in neuronal signaling. [provided by RefSeq
- Other Designations:
- Flotillin 2 (epidermal surface antigen 1),membrane component, chromosome 17, surface marker 1 (35kD protein identified by monoclonal antibody ECS-1)
- Gene Pathway
