Product Browser

Last updated: 2014/12/14

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FOXO3A (Human) Recombinant Protein (Q01)

  • Catalog # : H00002309-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FOXO3A partial ORF ( AAH21224, 361 a.a. - 460 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.63
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002309-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2309
  • Gene Name:
  • FOXO3
  • Gene Alias:
  • AF6q21,DKFZp781A0677,FKHRL1,FKHRL1P2,FOXO2,FOXO3A,MGC12739,MGC31925
  • Gene Description:
  • forkhead box O3
  • Gene Summary:
  • This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016944,forkhead box O3A,forkhead homolog (rhabdomyosarcoma) like 1,forkhead, Drosophila, homolog of, in rhabdomyosarcoma-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook