Product Browser
 
  • Related Product Showcase
  • By Research Area
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

FOXG1B polyclonal antibody (A01)   

  • Catalog # : H00002290-A01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 50 uL
  • USD $ 229
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant FOXG1B.
  • Immunogen:
  • FOXG1B (NP_005240, 183 a.a. ~ 291 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PFSYNALIMMAIRQSPEKRLTLNGIYEFIMKNFPYYRENKQGWQNSIRHNLSLNKCFVKVPRHYDDPGKGNYWMLDPSSDDVFIGGTTGKLRRRSTTSRAKLAFKRGAR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002290-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2290
  • Gene Name:
  • FOXG1
  • Gene Alias:
  • BF1,BF2,FHKL3,FKH2,FKHL1,FKHL2,FKHL3,FKHL4,FOXG1A,FOXG1B,FOXG1C,HBF-1,HBF-2,HBF-3,HBF-G2,HBF2,HFK1,HFK2,HFK3,KHL2,QIN
  • Gene Description:
  • forkhead box G1
  • Gene Summary:
  • This gene belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of the brain and telencephalon. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000178764,brain factor 2,forkhead box G1A,forkhead box G1B,forkhead box G1C,forkhead, drosophila, homolog-like 2,forkhead-like 1,forkhead-like 2,forkhead-like 3,forkhead-like 4,oncogene QIN
  • Related Disease
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!