FGR monoclonal antibody (M02), clone 3B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant FGR.
Immunogen
FGR (AAH64382, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA
Host
Mouse
Reactivity
Human, Mouse, Rat
Interspecies Antigen Sequence
Mouse (56); Rat (60)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.53 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in Raw 264.7 ( Cat # L024V1 ).Western Blot (Cell lysate)
FGR monoclonal antibody (M02), clone 3B11. Western Blot analysis of FGR expression in PC-12 ( Cat # L012V1 ).Western Blot (Cell lysate)
FGR monoclonal antibody (M02), clone 3B11 Western Blot analysis of FGR expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGR is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — FGR
Entrez GeneID
2268GeneBank Accession#
BC064382Protein Accession#
AAH64382Gene Name
FGR
Gene Alias
FLJ43153, MGC75096, SRC2, c-fgr, c-src2, p55c-fgr, p58c-fgr
Gene Description
Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
Omim ID
164940Gene Ontology
HyperlinkGene Summary
This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq
Other Designations
OTTHUMP00000003601|OTTHUMP00000003602|OTTHUMP00000003603|c-fgr protooncogene|c-src-2 proto-oncogene|p55-c-fgr protein|proto-oncogene tyrosine-protein kinase FGR
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com