- World's Largest Antibody and Recombinant Protein Manufacturer
- | Home
- | Contact Us
- Products
- Services
- Support
- Connection
- About us
 |
 |
-
- DNA & RNA (46)
- siRNA/Chimera (15364)
- Proteins/Peptides (25865)
- MaxPab® Ab (16217)
- Monoclonal Ab (21396)
- Polyclonal Ab (27483)
- Conjugate Ab/Beads (1328)
- Secondary/Tag Ab (1005)
- Lysates/Slides (9167)
- Ab Pairs/Kits (7698)
- Ab Array Det Kits (1)
- Ab Concentration Kits (1)
- Ab Labeling Kits (40)
- Ab Pairs for ELISA (1352)
- Ab Pairs for IP-WB (2015)
- Ab Pairs for PP (259)
- Ab Pairs for PPI (606)
- Ab Purification Kits (3)
- Assay Kits (521)
- Cell-Based ELISA Kits (708)
- CLIA Kits (44)
- ELISA Kits (2113)
- IHC Kits (6)
- IP & ChIP Kits (20)
- Mutation Detection Kits (3)
- Protein Expression Kits (6)
- Ab & Tissue Arrays (128)
- IHC/Pathology Ab (17916)
- In Situ Hybridization (1056)
- Circulating Tumor Cell (29)
- Systems (4)
- ASR/IVDiagnostics (21)
- Related Product Showcase
- By Research Area
- By Pathway
- By Disease
- By Antibody/Protein
 |
|
Click this icon to add products to compare list. Select up to 10 products.
- Home > Products > MaxPab® Ab > Human > Cell Cycle > FGF5 purified MaxPab rabbit polyclonal antibody (D01P)
FGF5 purified MaxPab rabbit polyclonal antibody (D01P) 
- Catalog # : H00002250-D01P
- Visit Frequency :
- Size
- Price
- In Stock
- Availability
- Cart
- 100 ug
- USD $ 359
- order now, ship next day
-
-
- The price is valid only in USA. Please select country.
- Ask us anything
- Payment Information
Credit card :
or Purchase Order Number
Email : sales@abnova.com
Phone : +1-909-992-0619 (new)
Fax : +1-909-992-3401- Products will be shipped directly to the customer.
- Specification
- Product Description:
- Rabbit polyclonal antibody raised against a full-length human FGF5 protein.
- Immunogen:
- FGF5 (NP_149134.1, 1 a.a. ~ 123 a.a) full-length human protein.
- Sequence:
- MSLSFLLLLFFSHLILSAWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSQVHR
- Host:
- Rabbit
- Reactivity:
- Human
- Quality Control Testing:
- Antibody reactive against mammalian transfected lysate.
- Storage Buffer:
- In 1x PBS, pH 7.2
- Storage Instruction:
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
- MSDS:
Download
- Applications
- Western Blot (Transfected lysate)
- Western Blot analysis of FGF5 expression in transfected 293T cell line (H00002250-T02) by FGF5 MaxPab polyclonal antibody.
Lane 1: FGF5 transfected lysate(13.00 KDa).
Lane 2: Non-transfected lysate. - Protocol Download
- In situ Proximity Ligation Assay (Cell)
- Proximity Ligation Analysis of protein-protein interactions between FGF5 and MAPK1 HeLa cells were stained with anti-FGF5 rabbit purified polyclonal 1:1200 and anti-MAPK1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Entrez GeneID:
- 2250
- GeneBank Accession#:
- NM_033143
- Protein Accession#:
- NP_149134.1
- Gene Name:
- FGF5
- Gene Alias:
- HBGF-5,Smag-82
- Gene Description:
- fibroblast growth factor 5
- Omim ID:
- 165190
- Gene Ontology:
- Hyperlink
- Gene Summary:
- The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified as an oncogene, which confers transforming potential when transfected into mammalian cells. Targeted disruption of the homolog of this gene in mouse resulted in the phenotype of abnormally long hair, which suggested a function as an inhibitor of hair elongation. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
- Other Designations:
- heparin-binding growth factor 5
