FGF1 monoclonal antibody (M02), clone 2E12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Mouse monoclonal antibody raised against a partial recombinant FGF1.
Immunogen
FGF1 (AAH32697, 46 a.a. ~ 155 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.73 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FGF1 expression in transfected 293T cell line by FGF1 monoclonal antibody (M02), clone 2E12.
Lane 1: FGF1 transfected lysate(17.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FGF1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of FGF1 transfected lysate using anti-FGF1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with FGF1 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FGF1 is approximately 10ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FGF1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — FGF1
Entrez GeneID
2246GeneBank Accession#
BC032697Protein Accession#
AAH32697Gene Name
FGF1
Gene Alias
AFGF, ECGF, ECGF-beta, ECGFA, ECGFB, FGF-alpha, FGFA, GLIO703, HBGF1
Gene Description
fibroblast growth factor 1 (acidic)
Omim ID
131220Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Multiple alternatively spliced variants encoding different isoforms have been described. [provided by RefSeq
Other Designations
OTTHUMP00000066028|OTTHUMP00000066030|OTTHUMP00000066031|OTTHUMP00000174675|endothelial cell growth factor, alpha|endothelial cell growth factor, beta|heparin-binding growth factor 1
-
Interactomes
-
Pathways
-
Diseases
-
Publication Reference
-
Neurovascular unit pathology is observed very early in disease progression in the mutant SOD1 G93A mouse model of amyotrophic lateral sclerosis.
Masaaki Yoshikawa, Shin Aizawa, Ronald W Oppenheim, Carol Milligan.
Experimental Neurology 2022 Jul; 353:114084.
Application:WB-Ti, Mouse, Mouse spinal cord.
-
Co-expression of podoplanin and fibroblast growth factor 1 predicts poor prognosis in patients with lung squamous cell carcinoma.
Li J, Chen H, Li X, Wang L, Gao A, Zhang P, Lin W, Gao W, Yang D, Guo X, Liu J, Dang Q, Sun Y.
Molecular MedicineRreports 2017 Jun; 16(2):1643.
Application:IHC-P, WB-Tr, Human, Human primary lung squamous cell carcinoma tissues, NCI‑H226 cells.
-
Repression of the DCL2 and DCL4 genes in Nicotiana benthamiana plants for the transient expression of recombinant proteins.
Matsuo K, Matsumura T.
Journal of Bioscience and Bioengineering 2017 Aug; 124(2):215.
Application:WB-Re, Recombinant protein.
-
A simple agroinfiltration method for transient gene expression in plant leaf discs.
Matsuo K, Fukuzawa N, Matsumura T.
Journal of Bioscience and Bioengineering 2016 Sep; 122(3):351.
Application:WB-Ti, Plant, Leaf discs.
-
Neurovascular unit pathology is observed very early in disease progression in the mutant SOD1 G93A mouse model of amyotrophic lateral sclerosis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com