FCN1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
FCN1 MaxPab polyclonal antibody. Western Blot analysis of FCN1 expression in human spleen.
Western Blot (Transfected lysate)
Western Blot analysis of FCN1 expression in transfected 293T cell line (H00002219-T01) by FCN1 MaxPab polyclonal antibody.
Lane 1: FCN1 transfected lysate(35.86 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human FCN1 protein.
Immunogen
FCN1 (NP_001994.2, 1 a.a. ~ 326 a.a) full-length human protein.
Sequence
MELSGATMARGLAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKDLLDRGYFLSGWHTIYLPDCRPLTVLCDMDTDGGGWTVFQRRMDGSVDFYRDWAAYKQGFGSQLGEFWLGNDNIHALTAQGSSELRVDLVDFEGNHQFAKYKSFKVADEAEKYKLVLGAFVGGSAGNSLTGHNNNFFSTKDQDNDVSSSNCAEKFQGAWWYADCHASNLNGLYLMGPHESYANGINWSAAKGYKYSYKVSEMKVRPA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
FCN1 MaxPab polyclonal antibody. Western Blot analysis of FCN1 expression in human spleen.Western Blot (Transfected lysate)
Western Blot analysis of FCN1 expression in transfected 293T cell line (H00002219-T01) by FCN1 MaxPab polyclonal antibody.
Lane 1: FCN1 transfected lysate(35.86 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — FCN1
Entrez GeneID
2219GeneBank Accession#
NM_002003.2Protein Accession#
NP_001994.2Gene Name
FCN1
Gene Alias
FCNM
Gene Description
ficolin (collagen/fibrinogen domain containing) 1
Omim ID
601252Gene Ontology
HyperlinkGene Summary
The ficolin family of proteins are characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. The collagen-like and the fibrinogen-like domains are also found separately in other proteins such as complement protein C1q, C-type lectins known as collectins, and tenascins. However, all these proteins recognize different targets, and are functionally distinct. Ficolin 1 encoded by FCN1 is predominantly expressed in the peripheral blood leukocytes, and has been postulated to function as a plasma protein with elastin-binding activity. [provided by RefSeq
Other Designations
OTTHUMP00000022519|ficolin (collagen/fibrinogen domain-containing) 1|ficolin 1
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com