FAU monoclonal antibody (M03), clone 3C10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant FAU.
Immunogen
FAU (AAH33877, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTQEVAGRMLGGKVHGSLARAGKVRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGKKKGPNANS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (40.37 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of FAU expression in transfected 293T cell line by FAU monoclonal antibody (M03), clone 3C10.
Lane 1: FAU transfected lysate(14.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to FAU on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — FAU
Entrez GeneID
2197GeneBank Accession#
BC033877Protein Accession#
AAH33877Gene Name
FAU
Gene Alias
FAU1, FLJ22986, Fub1, Fubi, MNSFbeta, RPS30
Gene Description
Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed
Omim ID
134690Gene Ontology
HyperlinkGene Summary
This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin. [provided by RefSeq
Other Designations
40S ribosomal protein S30|FAU-encoded ubiquitin-like protein|FBR-MuSV-associated ubiquitously expressed|Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV) ubiquitously expressed (fox derived)|Monoclonal nonspecific suppressor factor beta|ribosomal prote
-
Interactome
-
Pathway
-
Publication Reference
-
Global protein conjugation by ubiquitin-like-modifiers during ischemic stress is regulated by microRNAs and confers robust tolerance to ischemia.
Lee YJ, Johnson KR, Hallenbeck JM.
PLoS One 2012 Oct; 7(10):e47787.
Application:WB-Ti, WB-Tr, Human, I. tridecemlineatus, Brains, SH-SY5Y cells.
-
Global protein conjugation by ubiquitin-like-modifiers during ischemic stress is regulated by microRNAs and confers robust tolerance to ischemia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com