Product Browser
 
  • Related Product Showcase
  • By Research Area
  • By Application
Product Compare
 
  • Click this icon to add products to compare list. Select up to 10 products.
  • Choose your location
Integrated Solutions & Services
BULK
100% Guarantee_July
ISO

FBLN1 monoclonal antibody (M01), clone 4C9   

  • Catalog # : H00002192-M01
  • Visit Frequency :
  • Current Country :
  • Size
  • Price
  • In Stock
  • Availability
  • Cart
  • 100 ug
  • USD $ 319
  • Stock Image
  • order now, ship next day
  • Add to Cart
  • Payment Information

    Credit card :
    or Purchase Order Number

  • Email : sales@abnova.com
    Phone : +1-909-992-0619 (new)
    Fax : +1-909-992-3401
  • Products will be shipped directly to the customer.
  • Product Compare
  • Save To Interest Product
  • Add Review
  • Print
  • PDF Download
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant FBLN1.
  • Immunogen:
  • FBLN1 (AAH22497, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • GDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRDTGDEVVCSCFVGYQLLSDGVSCEDVNECITGSHSCRLGESCINTVGSFRCQRDSSCGT
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002192-M01
    Western Blot detection against Immunogen (36.74 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.2
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • FBLN1 monoclonal antibody (M01), clone 4C9 Western Blot analysis of FBLN1 expression in A-431 ( Cat # L015V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FBLN1 expression in transfected 293T cell line by FBLN1 monoclonal antibody (M01), clone 4C9.

    Lane 1: FBLN1 transfected lysate(74.4 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of FBLN1 transfected lysate using anti-FBLN1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FBLN1 MaxPab rabbit polyclonal antibody.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged FBLN1 is approximately 3ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2192
  • Gene Name:
  • FBLN1
  • Gene Alias:
  • FBLN
  • Gene Description:
  • fibulin 1
  • Gene Summary:
  • Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen. Four splice variants which differ in the 3' end have been identified. Each variant encodes a different isoform, but no functional distinctions have been identified among the four variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000028589
    If you have a question or comment, please select the topic you would like to contact.

Your message has been sent successfully!