Product Browser

Last updated: 2014/7/28
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FABP3 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00002170-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human FABP3 protein.
  • Immunogen:
  • FABP3 (NP_004093, 1 a.a. ~ 133 a.a) full-length human protein.
  • Sequence:
  • MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of FABP3 expression in transfected 293T cell line (H00002170-T01) by FABP3 MaxPab polyclonal antibody.

    Lane 1: FABP3 transfected lysate(14.63 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 2170
  • Gene Name:
  • FABP3
  • Gene Alias:
  • FABP11,H-FABP,MDGI,O-FABP
  • Gene Description:
  • fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor)
  • Gene Summary:
  • The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. [provided by RefSeq
  • Other Designations:
  • Fatty acid-binding protein 3, muscle,OTTHUMP00000003898,fatty acid binding protein 11,fatty acid binding protein 3,mammary-derived growth inhibitor
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook