Product Browser

Last updated: 2014/12/14
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EXTL2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00002135-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human EXTL2 protein.
  • Immunogen:
  • EXTL2 (AAH36015, 39 a.a. ~ 330 a.a) full-length human protein.
  • Sequence:
  • LLPSVKEDKMLMLRREIKSQGKSTMDSFTLIMQTYNRTDLLLKLLNHYQAVPNLHKVIVVWNNIGEKAPDELWNSLGPHPIPVIFKQQTANRMRNRLQVFPELETNAVLMVDDDTLISTPDLVFAFSVWQQFPDQIVGFVPRKHVSTSSGIYSYGSFEMQAPGSGNGDQYSMVLIGASFFNSKYLELFQRQPAAVHALIDDTQNCDDIAMNFIIAKHIGKTSGIFVKPVNMDNLEKETNSGYSGMWHRAEHALQRSYCINKLVNIYDSMPLRYSNITISQFGFPYANYKRKI
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of EXTL2 expression in transfected 293T cell line (H00002135-T01) by EXTL2 MaxPab polyclonal antibody.

    Lane 1: EXTL2 transfected lysate(36.41 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Detection Antibody
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Detection Antibody
  • Gene Information
  • Entrez GeneID:
  • 2135
  • Gene Name:
  • EXTL2
  • Gene Alias:
  • EXTR2
  • Gene Description:
  • exostoses (multiple)-like 2
  • Other Designations:
  • OTTHUMP00000013586,OTTHUMP00000013587,alpha-1,4-N-acteylhexosaminyltransferase,exostosin-like 2,multiple exostoses-like 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook