ETV4 monoclonal antibody (M01), clone 3G9-1B9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ETV4.
Immunogen
ETV4 (AAH07242, 1 a.a. ~ 207 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MYLHTEGFSGPSPGDGAMGYGYEKPLRPFPDDVCVAPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFIAWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKGGYSY
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (95); Rat (96)
Isotype
IgG2a kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (48.51 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ETV4 expression in transfected 293T cell line by ETV4 monoclonal antibody (M01), clone 3G9-1B9.
Lane 1: ETV4 transfected lysate(54 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ETV4 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — ETV4
Entrez GeneID
2118GeneBank Accession#
BC007242Protein Accession#
AAH07242Gene Name
ETV4
Gene Alias
E1A-F, E1AF, PEA3, PEAS3
Gene Description
ets variant 4
Omim ID
600711Gene Ontology
HyperlinkGene Summary
E1AF)|ets variant gene 4 (E1A enhancer-binding protein
Other Designations
E1A enhancer binding protein|EWS protein/E1A enhancer binding protein chimera|ets variant gene 4 (E1A enhancer binding protein, E1AF)|ets variant gene 4 (E1A enhancer-binding protein, E1AF)|polyomavirus enhancer activator-3
-
Interactome
-
Publication Reference
-
Identification and characterization of novel ETV4 splice variants in prostate cancer.
Irene Cosi, Annalisa Moccia, Chiara Pescucci, Uday Munagala, Salvatore Di Giorgio, Irene Sineo, Silvestro G Conticello, Rosario Notaro, Maria De Angioletti.
Scientific Reports 2023 Mar; 13(1):5267.
Application:WB-Ce, Human, Human prostatic carcinoma (PC3 cells and du145 cells).
-
Phosphoproteome and gene expression profiling of ALK inhibition in neuroblastoma cell lines reveals conserved oncogenic pathways.
Van den Eynden J, Umapathy G, Ashouri A, Cervantes-Madrid D, Szydzik J, Ruuth K, Koster J, Larsson E, Guan J, Palmer RH, Hallberg B.
Science Signaling 2018 Nov; 11(557):eaar5680.
Application:WB, Human, CLB-BAR, CLB-GE cells.
-
Overexpression of ETV4 is oncogenic in prostate cells through promotion of both cell proliferation and epithelial to mesenchymal transition.
Pellecchia A, Pescucci C, De Lorenzo E, Luceri C, Passaro N, Sica M, Notaro R, De Angioletti M.
Oncogenesis 2012 Jul; 1:e20.
Application:WB-Ce, Human, RWPE cells.
-
A fluorescence in situ hybridization screen for E26 transformation-specific aberrations: identification of DDX5-ETV4 fusion protein in prostate cancer.
Han B, Mehra R, Dhanasekaran SM, Yu J, Menon A, Lonigro RJ, Wang X, Gong Y, Wang L, Shankar S, Laxman B, Shah RB, Varambally S, Palanisamy N, Tomlins SA, Kumar-Sinha C, Chinnaiyan AM.
Cancer Research 2008 Sep; 68(18):7629.
Application:WB, Human, Human prostate cancer, HEK 293 cells.
-
Identification and characterization of novel ETV4 splice variants in prostate cancer.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com