Product Browser

Last updated: 2014/11/16

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ETS2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00002114-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ETS2 partial ORF ( AAH42954, 178 a.a. - 277 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • YEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00002114-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 2114
  • Gene Name:
  • ETS2
  • Gene Alias:
  • ETS2IT1
  • Gene Description:
  • v-ets erythroblastosis virus E26 oncogene homolog 2 (avian)
  • Gene Summary:
  • ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000115973,oncogene ETS-2,v-ets avian erythroblastosis virus E2 oncogene homolog 2,v-ets avian erythroblastosis virus E26 oncogene homolog 2,v-ets erythroblastosis virus E26 oncogene homolog 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook