Product Browser

Last updated: 2014/7/7
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ETS2 polyclonal antibody (A01)

  • Catalog # : H00002114-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant ETS2.
  • Immunogen:
  • ETS2 (AAH42954, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • YEENSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFPKSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHD
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00002114-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 2114
  • Gene Name:
  • ETS2
  • Gene Alias:
  • ETS2IT1
  • Gene Description:
  • v-ets erythroblastosis virus E26 oncogene homolog 2 (avian)
  • Gene Summary:
  • ETS transcriptions factors, such as ETS2, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000115973,oncogene ETS-2,v-ets avian erythroblastosis virus E2 oncogene homolog 2,v-ets avian erythroblastosis virus E26 oncogene homolog 2,v-ets erythroblastosis virus E26 oncogene homolog 2
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook