ETS1 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human ETS1 protein.
Immunogen
ETS1 (NP_005229.1, 1 a.a. ~ 441 a.a) full-length human protein.
Sequence
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
ETS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ETS1 expression in human spleen.Western Blot (Tissue lysate)
ETS1 MaxPab rabbit polyclonal antibody. Western Blot analysis of ETS1 expression in mouse intestine.Western Blot (Transfected lysate)
Western Blot analysis of ETS1 expression in transfected 293T cell line (H00002113-T02) by ETS1 MaxPab polyclonal antibody.
Lane 1: ETS1 transfected lysate(50.40 KDa).
Lane 2: Non-transfected lysate.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between ETS1 and MAPK1. HeLa cells were stained with anti-ETS1 rabbit purified polyclonal 1:1200 and anti-MAPK1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). -
Gene Info — ETS1
Entrez GeneID
2113GeneBank Accession#
NM_005238.2Protein Accession#
NP_005229.1Gene Name
ETS1
Gene Alias
ETS-1, EWSR2, FLJ10768
Gene Description
v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)
Omim ID
164720Gene Ontology
HyperlinkGene Summary
ETS transcriptions factors, such as ETS1, regulate numerous genes and are involved in stem cell development, cell senescence and death, and tumorigenesis. The conserved ETS domain within these proteins is a winged helix-turn-helix DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T of target genes (Dwyer et al., 2007 [PubMed 17986575]).[supplied by OMIM
Other Designations
Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1|ets protein|v-ets avian erythroblastosis virus E2 oncogene homolog 1|v-ets avian erythroblastosis virus E26 oncogene homolog 1|v-ets erythroblastosis virus E26 oncogene homolog 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Endothelial enriched microRNAs regulate angiotensin II-induced endothelial inflammation and migration.
Zhu N, Zhang D, Chen S, Liu X, Lin L, Huang X, Guo Z, Liu J, Wang Y, Yuan W, Qin Y.
Atherosclerosis 2011 Apr; 215(2):286.
Application:WB, Human, HUVECs.
-
Endothelial enriched microRNAs regulate angiotensin II-induced endothelial inflammation and migration.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com