ERBB3 monoclonal antibody (M07), clone 4H3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant ERBB3.
Immunogen
ERBB3 (AAH02706, 21 a.a. ~ 331 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (94); Rat (94)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ERBB3 on formalin-fixed paraffin-embedded human lung cancer. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ERBB3 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ERBB3
Entrez GeneID
2065GeneBank Accession#
BC002706Protein Accession#
AAH02706Gene Name
ERBB3
Gene Alias
ErbB-3, HER3, LCCS2, MDA-BF-1, MGC88033, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3
Gene Description
v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases. This membrane-bound protein has a neuregulin binding domain but not an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation. However, it does form heterodimers with other EGF receptor family members which do have kinase activity. Heterodimerization leads to the activation of pathways which lead to cell proliferation or differentiation. Amplification of this gene and/or overexpression of its protein have been reported in numerous cancers, including prostate, bladder, and breast tumors. Alternate transcriptional splice variants encoding different isoforms have been characterized. One isoform lacks the intermembrane region and is secreted outside the cell. This form acts to modulate the activity of the membrane-bound form. Additional splice variants have also been reported, but they have not been thoroughly characterized. [provided by RefSeq
Other Designations
erbB-3|lethal congenital contracture syndrome 2|v-erb-b2 avian erythroblastic leukemia viral oncogene homolog 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com