EIF4G1 monoclonal antibody (M01), clone 3A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EIF4G1.
Immunogen
EIF4G1 (NP_886553, 1500 a.a. ~ 1599 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
DVAVLKARAKLLQKYLCDEQKELQALYALQALVVTLEQPPNLLRMFFDALYDEDVVKEDAFYSWESSKDPAEQQGKGVALKSVTAFFKWLREAEEESDHN
Host
Mouse
Reactivity
Human, Mouse
Interspecies Antigen Sequence
Mouse (94); Rat (93)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EIF4G1 monoclonal antibody (M01), clone 3A10. Western Blot analysis of EIF4G1 expression in NIH/3T3(Cat # L018V1 ).Western Blot (Cell lysate)
EIF4G1 monoclonal antibody (M01), clone 3A10. Western Blot analysis of EIF4G1 expression in IMR-32 ( Cat # L008V1 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF4G1 is 0.03 ng/ml as a capture antibody.ELISA
-
Gene Info — EIF4G1
Entrez GeneID
1981GeneBank Accession#
NM_182917Protein Accession#
NP_886553Gene Name
EIF4G1
Gene Alias
DKFZp686A1451, EIF4F, EIF4G, p220
Gene Description
eukaryotic translation initiation factor 4 gamma, 1
Omim ID
600495Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a component of the protein complex EIF4F, which is involved in the recognition of the mRNA cap, ATP-dependent unwinding of 5'-terminal secondary structure, and recruitment of mRNA to the ribosome. Alternative splicing results in five transcript variants encoding four distinct isoforms. [provided by RefSeq
Other Designations
EIF4-gamma
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com