EIF4EBP1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human EIF4EBP1 full-length ORF ( AAH04459, 1 a.a. - 118 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.72
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EIF4EBP1
Entrez GeneID
1978GeneBank Accession#
BC004459Protein Accession#
AAH04459Gene Name
EIF4EBP1
Gene Alias
4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I
Gene Description
eukaryotic translation initiation factor 4E binding protein 1
Omim ID
602223Gene Ontology
HyperlinkGene Summary
This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. [provided by RefSeq
Other Designations
eIF4E-binding protein 1|phosphorylated heat- and acid-stable protein regulated by insulin 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com