EIF4EBP1 monoclonal antibody (M02), clone 1F7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF4EBP1 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (38.72 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant EIF4EBP1.
Immunogen
EIF4EBP1 (AAH04459, 1 a.a. ~ 118 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (91); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (38.72 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EIF4EBP1 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — EIF4EBP1
Entrez GeneID
1978GeneBank Accession#
BC004459Protein Accession#
AAH04459Gene Name
EIF4EBP1
Gene Alias
4E-BP1, 4EBP1, BP-1, MGC4316, PHAS-I
Gene Description
eukaryotic translation initiation factor 4E binding protein 1
Omim ID
602223Gene Ontology
HyperlinkGene Summary
This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. [provided by RefSeq
Other Designations
eIF4E-binding protein 1|phosphorylated heat- and acid-stable protein regulated by insulin 1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com