EPHA2 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specifications
Product Description
Human EPHA2 partial ORF ( AAH37166, 204 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
39.16
Interspecies Antigen Sequence
Mouse (82); Rat (84)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — EPHA2
Entrez GeneID
1969GeneBank Accession#
BC037166Protein Accession#
AAH37166Gene Name
EPHA2
Gene Alias
ECK
Gene Description
EPH receptor A2
Omim ID
176946Gene Ontology
HyperlinkGene Summary
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. [provided by RefSeq
Other Designations
ephrin receptor EphA2|epithelial cell receptor protein tyrosine kinase|protein tyrosine kinase|receptor protein tyrosine kinase regulated by p53 and E2F-1|soluble EPHA2 variant 1
-
Interactomes
-
Pathways
-
Diseases
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com