EPHA2 monoclonal antibody (M01), clone 6F8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EPHA2.
Immunogen
EPHA2 (AAH37166, 204 a.a. ~ 326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCT
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (82); Rat (84)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (39.16 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EPHA2 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — EPHA2
Entrez GeneID
1969GeneBank Accession#
BC037166Protein Accession#
AAH37166Gene Name
EPHA2
Gene Alias
ECK
Gene Description
EPH receptor A2
Omim ID
176946Gene Ontology
HyperlinkGene Summary
This gene belongs to the ephrin receptor subfamily of the protein-tyrosine kinase family. EPH and EPH-related receptors have been implicated in mediating developmental events, particularly in the nervous system. Receptors in the EPH subfamily typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. This gene encodes a protein that binds ephrin-A ligands. [provided by RefSeq
Other Designations
ephrin receptor EphA2|epithelial cell receptor protein tyrosine kinase|protein tyrosine kinase|receptor protein tyrosine kinase regulated by p53 and E2F-1|soluble EPHA2 variant 1
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
FMNL2 is a positive regulator of cell motility and metastasis in colorectal carcinoma.
Zhu XL, Zeng YF, Guan J, Li YF, Deng YJ, Bian XW, Ding YQ, Liang L.
The Journal of Pathology 2011 Jul; 224(3):377.
Application:WB-Ce, Human, CRC cell lines SW620, SW480, HT29.
-
FMNL2 is a positive regulator of cell motility and metastasis in colorectal carcinoma.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com