EFNA3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EFNA3 MaxPab rabbit polyclonal antibody. Western Blot analysis of EFNA3 expression in Jurkat.
Western Blot (Transfected lysate)
Western Blot analysis of EFNA3 expression in transfected 293T cell line (H00001944-T01) by EFNA3 MaxPab polyclonal antibody.
Lane 1: EFNA3 transfected lysate(26.40 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human EFNA3 protein.
Immunogen
EFNA3 (NP_004943.1, 1 a.a. ~ 238 a.a) full-length human protein.
Sequence
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLDIYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPIKFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EFNA3 MaxPab rabbit polyclonal antibody. Western Blot analysis of EFNA3 expression in Jurkat.Western Blot (Transfected lysate)
Western Blot analysis of EFNA3 expression in transfected 293T cell line (H00001944-T01) by EFNA3 MaxPab polyclonal antibody.
Lane 1: EFNA3 transfected lysate(26.40 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — EFNA3
Entrez GeneID
1944GeneBank Accession#
NM_004952.3Protein Accession#
NP_004943.1Gene Name
EFNA3
Gene Alias
EFL2, EPLG3, Ehk1-L, LERK3
Gene Description
ephrin-A3
Omim ID
601381Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNA class ephrin. [provided by RefSeq
Other Designations
OTTHUMP00000033243|eph-related receptor tyrosine kinase ligand 3|ephrin A3|ligand of eph-related kinase 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com