EDN3 monoclonal antibody (M01), clone 2A6-2A4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
EDN3 monoclonal antibody (M01), clone 2A6-2A4 Western Blot analysis of EDN3 expression in LNCaP ( Cat # L004V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of EDN3 expression in transfected 293T cell line by EDN3 monoclonal antibody (M01), clone 2A6-2A4.
Lane 1: EDN3 transfected lysate(25.5 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of EDN3 transfected lysate using anti-EDN3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EDN3 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EDN3 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (51.92 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant EDN3.
Immunogen
EDN3 (AAH08876, 1 a.a. ~ 238 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (51.92 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
EDN3 monoclonal antibody (M01), clone 2A6-2A4 Western Blot analysis of EDN3 expression in LNCaP ( Cat # L004V1 ).Western Blot (Transfected lysate)
Western Blot analysis of EDN3 expression in transfected 293T cell line by EDN3 monoclonal antibody (M01), clone 2A6-2A4.
Lane 1: EDN3 transfected lysate(25.5 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of EDN3 transfected lysate using anti-EDN3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with EDN3 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EDN3 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — EDN3
Entrez GeneID
1908GeneBank Accession#
BC008876Protein Accession#
AAH08876Gene Name
EDN3
Gene Alias
ET3, MGC15067, MGC61498
Gene Description
endothelin 3
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a member of the endothelin family. Endothelins are endothelium-derived vasoactive peptides involved in a variety of biological functions. The active form of this protein is a 21 amino acid peptide processed from the precursor protein. The active peptide is a ligand for endothelin receptor type B (EDNRB). The interaction of this endothelin with EDNRB is essential for development of neural crest-derived cell lineages, such as melanocytes and enteric neurons. Mutations in this gene and EDNRB have been associated with Hirschsprung disease (HSCR) and Waardenburg syndrome (WS), which are congenital disorders involving neural crest-derived cells. Four alternatively spliced transcript variants encoding three distinct isoforms have been observed. [provided by RefSeq
Other Designations
OTTHUMP00000031420|truncated endothelin 3
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com