EDG1 monoclonal antibody (M03), clone 1F11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of EDG1 expression in transfected 293T cell line by EDG1 monoclonal antibody (M03), clone 1F11.
Lane 1: EDG1 transfected lysate(42.8 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EDG1 is approximately 0.3ng/ml as a capture antibody.
Western Blot detection against Immunogen (30.91 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant EDG1.
Immunogen
EDG1 (AAH18650, 1 a.a. ~ 47 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (77); Rat (75)
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (30.91 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of EDG1 expression in transfected 293T cell line by EDG1 monoclonal antibody (M03), clone 1F11.
Lane 1: EDG1 transfected lysate(42.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged EDG1 is approximately 0.3ng/ml as a capture antibody.ELISA
-
Gene Info — S1PR1
Entrez GeneID
1901GeneBank Accession#
BC018650Protein Accession#
AAH18650Gene Name
S1PR1
Gene Alias
CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, FLJ58121, S1P1
Gene Description
sphingosine-1-phosphate receptor 1
Omim ID
601974Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq
Other Designations
G protein-coupled sphingolipid receptor|OTTHUMP00000012525|endothelial differentiation, sphingolipid G-protein-coupled receptor, 1|sphingosine 1-phosphate receptor EDG1
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com