Product Browser

Last updated: 2014/4/21
  • Related Product Showcase

Product Compare

Product Compare Cancel   Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
BIOtech
BULK-new

EDG1 monoclonal antibody (M01), clone 2E12

  • Catalog # : H00001901-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant EDG1.
  • Immunogen:
  • EDG1 (AAH18650, 1 a.a. ~ 47 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001901-M01
    Western Blot detection against Immunogen (30.91 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • EDG1 monoclonal antibody (M01), clone 2E12 Western Blot analysis of EDG1 expression in Jurkat ( Cat # L017V1 ).
  • Protocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of EDG1 expression in transfected 293T cell line by EDG1 monoclonal antibody (M01), clone 2E12.

    Lane 1: EDG1 transfected lysate(42.8 KDa).
    Lane 2: Non-transfected lysate.
  • Protocol Download
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Detection limit for recombinant GST tagged EDG1 is approximately 0.1ng/ml as a capture antibody.
  • Protocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • Sandwich ELISA (Recombinant protein)
  • enlarge
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1901
  • Gene Name:
  • S1PR1
  • Gene Alias:
  • CHEDG1,D1S3362,ECGF1,EDG-1,EDG1,FLJ58121,S1P1
  • Gene Description:
  • sphingosine-1-phosphate receptor 1
  • Gene Summary:
  • The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq
  • Other Designations:
  • G protein-coupled sphingolipid receptor,OTTHUMP00000012525,endothelial differentiation, sphingolipid G-protein-coupled receptor, 1,sphingosine 1-phosphate receptor EDG1
  • RSS
  • YouTube
  • Linkedin
  • Facebook