Product Browser

Last updated: 2014/12/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

S1PR1 (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00001901-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human S1PR1 full-length ORF (NP_001391.2) recombinant protein without tag.
  • Sequence:
  • MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.8
  • Form:
  • Liquid
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 1901
  • Gene Name:
  • S1PR1
  • Gene Alias:
  • CHEDG1,D1S3362,ECGF1,EDG-1,EDG1,FLJ58121,S1P1
  • Gene Description:
  • sphingosine-1-phosphate receptor 1
  • Gene Summary:
  • The protein encoded by this gene is structurally similar to G protein-coupled receptors and is highly expressed in endothelial cells. It binds the ligand sphingosine-1-phosphate with high affinity and high specificity, and suggested to be involved in the processes that regulate the differentiation of endothelial cells. Activation of this receptor induces cell-cell adhesion. [provided by RefSeq
  • Other Designations:
  • G protein-coupled sphingolipid receptor,OTTHUMP00000012525,endothelial differentiation, sphingolipid G-protein-coupled receptor, 1,sphingosine 1-phosphate receptor EDG1
  • RSS
  • YouTube
  • Linkedin
  • Facebook